Dataset for protein Bfl1 of organism Nomascus leucogenys

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I3HBP6_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3HBP6_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=205 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFDDVT
© 1998-2019