Dataset for protein Unclassified of organism Neolamprologus brichardi

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q4H341_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neolamprologus brichardi (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPRPDPPVAPPCLQAVLRSAGDELERLYGDELSAQVTVLRLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3Q4HDS7_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neolamprologus brichardi (length=122 residues).
MHVHTGMLSLQTTATEVPMVTGVVRTLFSDGIINWGRVVSLVAYGTVLLQASKSTLGPECAYGIGVSIAAYITDNHMDWL
VGTDGWDGFVDTFDRVHQRLWLSMQGKLLLLGVGLGLLSVLL
>gnl|bcl2dbpro|A0A3Q4HE32_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neolamprologus brichardi (length=224 residues).
MANEYNRNIVEKYICHKLSKRGYVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWVCLIPNISYRRGLLQAAALSIGPTRTFFFQQSLRYLHLKDV
>gnl|bcl2dbpro|A0A3Q4N9S0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Neolamprologus brichardi (length=226 residues).
MCQMIHRYDWQERSWHLISLALQRRSRVKMQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAKSLPAYNGIE
VLKSALLDSGEQFGFLFTQSFRDVASHLCITPDTAQQCFKSVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
© 1998-2019