Dataset for protein BCL-2-like of organism Neolamprologus brichardi

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q4HLQ8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neolamprologus brichardi GN=MCL-1 (length=272 residues).
MTNYMMSKRNQCTFIDYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYTTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRVVSFVAFGAVVSQHLKEKGRDNCVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q4MN81_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Neolamprologus brichardi GN=BCL2L10 (length=204 residues).
MCREQSDIAGRKMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
HCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWLLD
NDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q4N4B5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Neolamprologus brichardi GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWEHFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
© 1998-2019