Dataset for protein Unclassified of organism Nematostella vectensis

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A7S109_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Nematostella vectensis (length=142 residues).
MVKDFIGYKLRQNNIFLEGFNMESPTKASKHLRIVADELIADNSELFHSMCDQLHLTPISTYPTFVGIANEIFQSGKNWG
RVVAFLAFGATLAVYCAQREELHELVNDIVEWVSRYMDQNLSCWIRENGGWVRFQQVFLALK
>gnl|bcl2dbpro|A7S9S4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=163 residues).
MAALQAQRKPCSETLETLNRQAHFLAQDLISYRTGNGRISTSLTARNMRRLSDELEERHGPLLCNMCNSLNMTANSAHEK
FVQVADEVFKDGINWGRIVAVFTFGGRLAQFCARNGLHDGVREVEAWLGDYIANLSHWIQTQGGWVCTFETSQSHDSANF
ARF
>gnl|bcl2dbpro|A7SFS9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=180 residues).
MEYPRNDPRQSYPELVHQAQLLAKDLISYRLGKNPKPPNANAETLRKLADKIEEQYPALLNHLCHKLNISRSTAYSTFVE
IAGEVFADGVNWGRIVVLYAFGGRLAVYCEQHNMKDLVQSVTDWVGKYIAGLSEWIANEGGWDGLKEQFRDNNTNDTTWW
KGVFITTLGIGTLAALVYTR
>gnl|bcl2dbpro|A7SPR2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=188 residues).
MPPIEGYDNANAVAARKMKTPEEKIAHELAKDFIGYKLGKGTRLNTKSALILRKLSNQIENKHELFLRNMCDRLDIRQHN
APETFKQVADEIFGDGINWGRIVVLYTFAGKVAKYCQENQLDNAENVATWVGNYVASKSDWVKKAGGWEAFNEQFKDVQE
EHEKFWWNSLLCTTLGLGSLAAVLYMKS
© 1998-2019