Dataset for protein Bcl-xL of organism Mytilus galloprovincialis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|R4JQR8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mytilus galloprovincialis GN=BCL2L1 (length=185 residues).
MNQFSSRYLVADFINDRLRKHGMRWDNCPTLDLPPSQIQLKLRSLGDEFQERFQTQFDDMVNQLHITEATAYPTFQRVVQ
ELFIDGNINWGRIVALFGFGGSLSVKCVQRGMPQLVDSIVDWVSTYLCNSLEQWITDNGGWQGFVEAYNQGQNHNDSPWD
VKGLVKYGAIGVIGAMALSAFLHRT
© 1998-2019