Dataset for protein Mcl-1 of organism Myotis lucifugus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G1PZ39_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Myotis lucifugus GN=MCL-1 (length=264 residues).
APPSPISGRGPRRHRDPSRGGCLRPLAVRGCPRRWKAAAADAIMSPEEELDGYEPEPLGKRPAVLPLVQLVGEASGGPGA
GGSLPSTPPPAEEEEDELFRQSLEIISRYREQATGAKDAKPLGGPAASSRKALETLRRVGDGVQRNHEMAFQGERGPRAL
CLVRDRWAPVGGNRDEPGLEGLSARFRNQHILAMSHCFRPPDSLGTALRSKAGKVWETSNTCHGFKDGFVEFFHVEDLEG
GIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1QAV8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Myotis lucifugus GN=MCL-1 (length=324 residues).
MFGPKRNAFIGLNLHCGGAVGGLWRQRSLHLLQEGGPCPQESGAGRETGTVIGWSAGASPQATLARDPGRVARPSPMGTE
GPDGTAAPARWLFSPISRNCPEELGALAADAIMSPGEELGRYEPEPKQPAVLPLLQLVGEASEGPAGGSLPSTPPPAEEE
EELSLLEMIPQHLRERAGARDQSQGPRVGGVQRRAAGCSGVRQETAFLGMLELDTENEDNVKSSSQAMVHAFRDGVTNGR
IVTHFFWCLCSHLKSINQESCIEPLAEDITDVLVGTERGWLVKQRGWDGFVEFFQVEDLEGGVRNVLLAFAGAGVGAGLP
YLIR
© 1998-2019