Dataset for protein BCL-2-like of organism Myotis lucifugus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|G1P3J2_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L2 (length=219 residues).
PEMLHSVSLTKYTHASLLSLTFTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
TRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRL
ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G1P9D2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G1PZ39_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Myotis lucifugus GN=MCL-1 (length=264 residues).
APPSPISGRGPRRHRDPSRGGCLRPLAVRGCPRRWKAAAADAIMSPEEELDGYEPEPLGKRPAVLPLVQLVGEASGGPGA
GGSLPSTPPPAEEEEDELFRQSLEIISRYREQATGAKDAKPLGGPAASSRKALETLRRVGDGVQRNHEMAFQGERGPRAL
CLVRDRWAPVGGNRDEPGLEGLSARFRNQHILAMSHCFRPPDSLGTALRSKAGKVWETSNTCHGFKDGFVEFFHVEDLEG
GIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1Q051_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L2 (length=206 residues).
MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQAPDTQALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
THFRCTFSDLVAQLHVTPGSAQQCFTQVSDELFQGGPNWGYLVAFFVFGAALCVESVNKEMEPLVGQVQEWTVAYLEMRL
ADWIHSIGGWAEFTALYGNWASVRTVLTGALALRALLTVGAFFASM
>gnl|bcl2dbpro|G1QAV8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Myotis lucifugus GN=MCL-1 (length=324 residues).
MFGPKRNAFIGLNLHCGGAVGGLWRQRSLHLLQEGGPCPQESGAGRETGTVIGWSAGASPQATLARDPGRVARPSPMGTE
GPDGTAAPARWLFSPISRNCPEELGALAADAIMSPGEELGRYEPEPKQPAVLPLLQLVGEASEGPAGGSLPSTPPPAEEE
EELSLLEMIPQHLRERAGARDQSQGPRVGGVQRRAAGCSGVRQETAFLGMLELDTENEDNVKSSSQAMVHAFRDGVTNGR
IVTHFFWCLCSHLKSINQESCIEPLAEDITDVLVGTERGWLVKQRGWDGFVEFFQVEDLEGGVRNVLLAFAGAGVGAGLP
YLIR
>gnl|bcl2dbpro|G1QEX2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L10 (length=179 residues).
DELKLRTRRLLTEFLEHRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSRRQRNRLEQMVDQIESLVPDGTDPNWL
SVVALVSFAGALLERPPPGHSQARREWDATVDQDCQRLVTFLCSWLTETHRTWMEAQGGWDGFCHNFMPAPPPGDRLLAP
LLRACLVLIILICLWIKIM
© 1998-2019