Dataset for protein Bcl2l10 of organism Myotis lucifugus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1QEX2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L10 (length=179 residues).
DELKLRTRRLLTEFLEHRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSRRQRNRLEQMVDQIESLVPDGTDPNWL
SVVALVSFAGALLERPPPGHSQARREWDATVDQDCQRLVTFLCSWLTETHRTWMEAQGGWDGFCHNFMPAPPPGDRLLAP
LLRACLVLIILICLWIKIM
© 1998-2019