Dataset for protein Unclassified of organism Myotis gammaherpesvirus 8

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A109QG17_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Viruses] Myotis gammaherpesvirus 8 (length=177 residues).
MAHAGRTEYDNREIVMKYIHYKLASAGLGGDAARMPLSAATGGDETDAPDPLQEALQVTGTGIGLVFAHRSGAGLGDCLQ
FNEENAQTTFLQVVDELFRDGVNWGRIVAFFEFGGVMCVESVNRGIPSLVDNIAAWMTDQLGGEVGLWIQENGGWHTFEH
MINPPPERHRNRRCNIL
© 1998-2019