Dataset for protein BCL-2-like of organism Mustela putorius furo

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|M3XZZ5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mustela putorius furo GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGTGGASSSGGRLLASGKEATARREVGGGEAGAVIGGSAGASTPATLAPDARRVARPS
PIGAEGPNVTATPPRLLFFEPTHRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGPGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|M3Y5X5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L2 (length=219 residues).
KPEAPLLAFQPYIHASLSSLTLTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
TRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRL
ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|M3Y8D1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L10 (length=226 residues).
MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLEYCARGPGTPARSPSTREAAVLRSVAAVVRQRHE
RFLSDYRGYGGNRVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSNLGPDPELELELGEWEASVRQDCR
RLVDFLCGRLTGQHRAWLEAHGGWDGFCLFFTPALLSWKRLLVQALLSCFTAVILIYFWKRLPFIG
>gnl|bcl2dbpro|M3YVH4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2A1 (length=174 residues).
MTDSEFGYTLSLAQDYVRHVLQIPQPSPAASRVSRVLRDVASSVQGEVEQNLRPCLDSFDVGSIDTARTIFNQVMEKEFE
DGIINWGRIVTVFAFEGILSKKLLRERISPDVDASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVI
GKICEMFSLLKQYY
>gnl|bcl2dbpro|M3YYK3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mustela putorius furo GN=BCL-2 (length=207 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGRPVMKLVYLPTAPPPPPLSRHRRPQLTSPATALAAAAAAGPALSPVPPVVHLT
LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW
MTEYLNRHLHTWIQDNGGWPAPAPHEGPAARPIVDDSYWPKVFSLLA
>gnl|bcl2dbpro|M3Z2H9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019