Dataset for protein Bcl-w of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3Y5X5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L2 (length=219 residues).
KPEAPLLAFQPYIHASLSSLTLTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
TRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRL
ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019