Dataset for protein Bfl1 of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3YVH4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2A1 (length=174 residues).
MTDSEFGYTLSLAQDYVRHVLQIPQPSPAASRVSRVLRDVASSVQGEVEQNLRPCLDSFDVGSIDTARTIFNQVMEKEFE
DGIINWGRIVTVFAFEGILSKKLLRERISPDVDASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVI
GKICEMFSLLKQYY
© 1998-2019