Dataset for protein Bcl-2 of organism Mustela putorius furo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3YYK3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mustela putorius furo GN=BCL-2 (length=207 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGRPVMKLVYLPTAPPPPPLSRHRRPQLTSPATALAAAAAAGPALSPVPPVVHLT
LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW
MTEYLNRHLHTWIQDNGGWPAPAPHEGPAARPIVDDSYWPKVFSLLA
© 1998-2019