Dataset for protein Mcl-1 of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|P97287_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus musculus GN=MCL-1 (length=285 residues).
MFGLRRNAVIGLNLYCGGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLE
RVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDW
LVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|P97287_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus musculus GN=MCL-1 (length=331 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVA
GVGAGLAYLIR
© 1998-2019