Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

22 sequence(s)

>gnl|bcl2dbpro|D3Z5F7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=333 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRSRYRARTTNYNSSRSRFYSGFNSRPRGRIY
RGRARATSWYSPY
>gnl|bcl2dbpro|O35843_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=235 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWGVSGGTPLRSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
>gnl|bcl2dbpro|O55177_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|O55178_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHNE
>gnl|bcl2dbpro|O55179_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|P10417_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mus musculus GN=BCL-2 (length=199 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGACLVE
>gnl|bcl2dbpro|P10417_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mus musculus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|P70345_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=79 residues).
MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|P70345_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|P70345_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=178 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQLLLSASLYKVG
LHGKIGPLMGGWGCAGKG
>gnl|bcl2dbpro|P97287_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus musculus GN=MCL-1 (length=285 residues).
MFGLRRNAVIGLNLYCGGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLE
RVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDW
LVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|P97287_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus musculus GN=MCL-1 (length=331 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVA
GVGAGLAYLIR
>gnl|bcl2dbpro|Q07440_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q0P538_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
NGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHHE
>gnl|bcl2dbpro|Q497M6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q4FK02_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q64373_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q64373_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-09 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q8K164_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q9Z0F3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mus musculus GN=BCL2L10 (length=191 residues).
MADSQDPLHERTRRLLSDYIFFCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSSFCESRGNRLELVKQMADKLLS
KDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVIVTRDCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFFKN
PLPLGFWRRLLIQAFLSGFFATAIFFIWKRL
© 1998-2019