Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|D3Z5F7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=333 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRSRYRARTTNYNSSRSRFYSGFNSRPRGRIY
RGRARATSWYSPY
>gnl|bcl2dbpro|P70345_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=79 residues).
MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|P70345_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|P70345_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Mus musculus GN=BCL2L2 (length=178 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQLLLSASLYKVG
LHGKIGPLMGGWGCAGKG
© 1998-2019