Dataset for protein Bcl-xL of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|O35843_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=235 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWGVSGGTPLRSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
>gnl|bcl2dbpro|Q64373_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q64373_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-09 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019