Dataset for protein Bfl1 of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|O55177_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|O55178_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHNE
>gnl|bcl2dbpro|O55179_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q07440_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q0P538_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
NGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHHE
>gnl|bcl2dbpro|Q497M6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q4FK02_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q8K164_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
© 1998-2019