Dataset for protein Unclassified of organism Monopterus albus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3QYY1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monopterus albus (length=147 residues).
MWRLQRILLAARICRFRLGFLIWTLYFKGMIATLSSHDGGSVVRSIGLVAGSIFADGTANWGRVASLVAFGATVCRYLKE
RGGEDCTEQMGEEISAYLLTDQKEWLIKNDSWDGFVTFFANSESTLRRNILVTFVGIGVITLALLIV
© 1998-2019