Dataset for protein BCL-2-like of organism Monopterus albus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q3IVF5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=223 residues).
MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGEEATHANGTFNGTSPGTPPASPLRQQQLPSTANLDAVKEALRD
SANEFELRYARAFSDLHHQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLVGRIVEWMTV
YLDNHIQPWIQGQGGWERFAELFGQDAAAENRRSQESFKKWLLAGMTLVTGVVVGSLIIQKRL
>gnl|bcl2dbpro|A0A3Q3IZW0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monopterus albus GN=MCL-1 (length=304 residues).
MNIITSKKWADVNVTTEIMSLILPQNGVVEGSMHCGSNTSPQFAVGSSIDSCKGNVGPNNTLKRPKILDVSSTNGYGTKT
LVDVSDIDNGSLPCSPVLQPDNEIEVSSSPAEYEVLENDTRLLICHFLRDYTGLSTHRWTRRKTLSTMKRVVEGVLEKHR
YAYKGMINKLSLDERGDDMSFVGSVAQSIFADGTTNWGRITSLLAFGAVVCQYLKEKGRENCVELVGQEISTYLLSHQRD
WLVKNNAWDGFEEFFRVADPESTVRTTLMAFAGFAGIGATLALLIRTNNTCGGLKRKWSRASPW
>gnl|bcl2dbpro|A0A3Q3J5K3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=202 residues).
MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATTNGLGIEAVKAALRDSADEFELRFTQAFSDLSSQL
VITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFAFGGALCVECVEKNMSELVSRIADWMTMYLDEHISPWIQNQGGWDCFA
EIFGRDNAAEVRRSQETLRRWLLVGVVLLTGVLVGVLVAKKL
>gnl|bcl2dbpro|A0A3Q3JQ78_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Monopterus albus GN=BCL2L10 (length=219 residues).
MCREHLDIAGRKMSCGLWKDTLALAEDYLSLCCTSSRPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLKQCGPDP
CSSLRKVMEELVGDGHLNWGRVVSLFAFTGVLARQLTEQNGMKPGLDPGQGQELGQGPGNCRELAETIADYLGEEKKDWL
LENDGWEGFCKFSRSAREVSHDSSVKTALFAAAGVGLAGLTFLLETSGTCEREQFRKSD
>gnl|bcl2dbpro|A0A3Q3K1K1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Monopterus albus GN=BCL-2 (length=228 residues).
MANECNRNVVEKYICHKLSKRGYVWGFHDVQDEDAANNGSIVAPPPTLVRRCREASTGPDSESTPHRCKRPPQSDMHAAI
HRVLREAGDELERLYQPDFTEMSRQLHLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTMCVECAAKEEMTPQVDK
IAEWMTEYLNGPLNSWIQENGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019