Dataset for protein Bcl-xL of organism Monopterus albus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3IVF5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=223 residues).
MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGEEATHANGTFNGTSPGTPPASPLRQQQLPSTANLDAVKEALRD
SANEFELRYARAFSDLHHQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLVGRIVEWMTV
YLDNHIQPWIQGQGGWERFAELFGQDAAAENRRSQESFKKWLLAGMTLVTGVVVGSLIIQKRL
>gnl|bcl2dbpro|A0A3Q3J5K3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=202 residues).
MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATTNGLGIEAVKAALRDSADEFELRFTQAFSDLSSQL
VITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFAFGGALCVECVEKNMSELVSRIADWMTMYLDEHISPWIQNQGGWDCFA
EIFGRDNAAEVRRSQETLRRWLLVGVVLLTGVLVGVLVAKKL
© 1998-2019