Dataset for protein Bcl-2 of organism Monopterus albus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3K1K1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Monopterus albus GN=BCL-2 (length=228 residues).
MANECNRNVVEKYICHKLSKRGYVWGFHDVQDEDAANNGSIVAPPPTLVRRCREASTGPDSESTPHRCKRPPQSDMHAAI
HRVLREAGDELERLYQPDFTEMSRQLHLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTMCVECAAKEEMTPQVDK
IAEWMTEYLNGPLNSWIQENGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019