Dataset for protein Unclassified of organism Monodelphis domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7CVK3_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Monodelphis domestica (length=140 residues).
MASPVSTDVPALAADFVHYKLKQKTYDNLLGLEENFFAGVPSREPLHLAMHSSGDQYEFFCNNTTIDLDHAMKYFNHAAD
EIFEQGITRGYIVGFFYFSVAFGSCCIGSTKSSPIQLVKNWMVIYIETKLMNWIHQNGTY
© 1998-2019