Dataset for protein Mcl-1 of organism Monodelphis domestica

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F6ZMX1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodelphis domestica GN=MCL-1 (length=396 residues).
MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPV
SPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREG
GDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKTKRDWLIKQKGWKGL
LAQDTEEATRTGDPCAPSSAYLLLCAEPLFWWCQLTASGCHVPDKPRNVLTEERKWAASLQRSHNKFSTSMITHGL
>gnl|bcl2dbpro|F6ZMX1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodelphis domestica GN=MCL-1 (length=355 residues).
MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPV
SPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREG
GDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKTKRDWLIKQKGWEGF
VEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F6ZMX1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodelphis domestica GN=MCL-1 (length=333 residues).
MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPV
SPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREG
GDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKTKRDWLIKQKGWSGK
ERVDPRGLVSGGN
© 1998-2019