Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|F6SFL4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2A1 (length=172 residues).
MDDYEFHYVHMLARDYLKHVQQTPPLGSCLNKTSQILQKVAFSVQQEVEKDMETCLSTLDIVSVESARRIFNSVMKKEFE
DGVINWGRIVTIFAFGGILIKKLLRHRAPLTMGTQEEISHFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNTVWPNFTDI
STKIWGIFSFLK
>gnl|bcl2dbpro|F6U940_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTTEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|F6VJQ0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L10 (length=189 residues).
MDYKCALREETARLVTDYLEYCCRREGVQELPAPTPAAATLRLVSSELRQIYQDFFECALNQLLDREPEQVIVNVAELMD
RGEFNWGRVAVLVVFAGALLEMEELLKEEQVLQLRRETSRRLTEKLCNYLVERKGAWLHENGGWTGFHHHFEKRQSPPPS
DSSNNTLCCIMAAAAGFGLVGLALLLVVR
>gnl|bcl2dbpro|F6WA14_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L1 (length=227 residues).
MSHSNRELVIDFLSYKLSQKGYNWSQFEDENRTEVLEGAEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRI
TSWMATYLDDHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F6YNL8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Monodelphis domestica GN=BCL-2 (length=256 residues).
MMAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGDLRAPASPSLPPVVASAPAVGIFSTQPRNTPLPAEPQDSATSTTAA
ARNSPLPLPPPAVAAAAAAGPTVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVN
WGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGNSMRPLFDFSWLSLKTLLSL
ALVGACVTLGAYLGHK
>gnl|bcl2dbpro|F6ZMX1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodelphis domestica GN=MCL-1 (length=355 residues).
MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPV
SPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREG
GDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKTKRDWLIKQKGWEGF
VEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019