Dataset for protein Unclassified of organism Mola mola

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3X971_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mola mola (length=207 residues).
MAKEYNRDLVEIYLCHKLSKCGYVWRSDDVRDENATNNGSIVAPPATLAQRCREPRAAIHRVLREAGDELERLYAPDFTE
MSRQLYLTSSTAQGRFAEVIDELFRDGVNWGRIIAFFEFGGAVCAECASKEEMSPQVDNIAEWMTEYLNGPLNSWIQDNG
GWDAFVELYDRQRDSVLSCSWPSFKTVFGMAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A3Q4BUL3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mola mola (length=228 residues).
MEKTETHLTPGLYLFQLPSVKKHLHLLVSTTNYNDAANNNKCEMWNLTGVVSHQLSERRKPKRSNIPPLKQNCNPAPPRL
QAVLRSATDELEQRYAGELAAHVSLLLLRDGGGPERRRGLTAVTEELFEDGVNWGRIVAMMELGGVLCTEVVRRGGAWQL
DDVAKWMEDSLESPRLREWMQENGGWDAFVELYGESRPAVRFWSLRTVFGLAVLGAAGITLGALISWR
© 1998-2019