Dataset for protein Mcl-1 of organism Mola mola

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3VP02_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mola mola GN=MCL-1 (length=262 residues).
MNVLFQNGVVSGPTRSSQIGMGSCLDSHNGNVALNDTSKRPNLLVVNPTKEYMGKPIRKDSTDTDDDGSLPYTPDMSPDS
ELNVSGCLAGDELLEKDTRQLISRVLMELSGHGRARWTESRTLSTMKRVVAELLEKHRYVYNGMTKRLSLADTQDNVSFV
STVSRDLFSDGATNWGRIASLVAFGVVVSQCLKENGKSDRVELVAHEISTYLLTDQRDWMCVGGDGFVEFFRVADPESTV
RNALMTIAGVAGIGATLALLIR
© 1998-2019