Dataset for protein BCL-2-like of organism Mola mola

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q3VI28_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mola mola GN=BCL2L10 (length=196 residues).
MSCGLWKETLALAQDYLSLCCTSQRPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLRQCGTDPCSSLRNVMEELV
GDGHLNWGRVVSIFTFTGVLARQLLEQKSTKPGLEPRQDQDQELGQVPGNCSELAETIADYLGEEKKAWLLENDGWEGFC
KFSHSAREARLDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3VP02_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mola mola GN=MCL-1 (length=262 residues).
MNVLFQNGVVSGPTRSSQIGMGSCLDSHNGNVALNDTSKRPNLLVVNPTKEYMGKPIRKDSTDTDDDGSLPYTPDMSPDS
ELNVSGCLAGDELLEKDTRQLISRVLMELSGHGRARWTESRTLSTMKRVVAELLEKHRYVYNGMTKRLSLADTQDNVSFV
STVSRDLFSDGATNWGRIASLVAFGVVVSQCLKENGKSDRVELVAHEISTYLLTDQRDWMCVGGDGFVEFFRVADPESTV
RNALMTIAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q3WIW8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=230 residues).
MSVNRELVAYYINYKLSHRGCPLNHMGLIEPPNRTEGGQAVSDEEQRVATHANGTFNGTSPGTPPRSPLRLQPSTTSLDA
VKDALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGR
IIEWMTVYLDNQIQPWIESQGGWQRFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIVQKRL
>gnl|bcl2dbpro|A0A3Q3X5M5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=218 residues).
MSHSNRELVEFFISYKLTQKNYPTSLLRPEDTGGRTEGDKASSAARNGLLVNSSSRGGLSPSTGADMEAVKSALRDSANE
FEQLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECAEKDTGELVCRIADWMTTYLDE
HINPWIQSQGGWGCFAEVFGHNAAAEARRSQETLNRWLLVGVALLMGVMVGVFIAKKQ
© 1998-2019