Dataset for protein Bcl-xL of organism Mola mola

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3WIW8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=230 residues).
MSVNRELVAYYINYKLSHRGCPLNHMGLIEPPNRTEGGQAVSDEEQRVATHANGTFNGTSPGTPPRSPLRLQPSTTSLDA
VKDALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGR
IIEWMTVYLDNQIQPWIESQGGWQRFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIVQKRL
>gnl|bcl2dbpro|A0A3Q3X5M5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=218 residues).
MSHSNRELVEFFISYKLTQKNYPTSLLRPEDTGGRTEGDKASSAARNGLLVNSSSRGGLSPSTGADMEAVKSALRDSANE
FEQLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECAEKDTGELVCRIADWMTTYLDE
HINPWIQSQGGWGCFAEVFGHNAAAEARRSQETLNRWLLVGVALLMGVMVGVFIAKKQ
© 1998-2019