Dataset for protein BCL-2-like of organism Mesocricetus auratus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A1U7QU73_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGAESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1U7QVA0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L10 (length=182 residues).
MADPLRVRTRLLLTDYLTFCAREPGDPEPPPTSAEAALLRSVAEQIQQQHHFFFSSFVGYQGNRVELMTQMVDAVLPDGQ
DLNWGRLVLLLAFAGTIVSQEQRNRLKDKMKVLQDCQLIVALLCNRLLRRHRSWLEAQGGWDGFCVIFGSPLPLDFWSTL
LIKTFLSCVIATAILFVWKRLL
>gnl|bcl2dbpro|A0A1U7RC37_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A1U7RC37_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2019