Dataset for protein Mcl-1 of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1MPY7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Meleagris gallopavo GN=MCL-1 (length=123 residues).
FSGMLRKLEIKKEEDLQAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLM
SQGGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2019