Dataset for protein BCL-2-like of organism Meleagris gallopavo

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|G1MPY7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Meleagris gallopavo GN=MCL-1 (length=123 residues).
FSGMLRKLEIKKEEDLQAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLM
SQGGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|G1MZW1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL-2 (length=106 residues).
VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGTSMRPLFDFS
WISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|G1N5N5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGAAVHRSSLEVHEIVRAS
DVRQTLRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|G1N8C5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVFSLFRDYY
© 1998-2019