Dataset for protein Bcl-xL of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1N5N5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGAAVHRSSLEVHEIVRAS
DVRQTLRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
© 1998-2019