Dataset for protein Bfl1 of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1N8C5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVFSLFRDYY
© 1998-2019