Dataset for protein Bcl-2 of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1MZW1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL-2 (length=106 residues).
VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGTSMRPLFDFS
WISLKTILSLVLVGACITLGAYLGHK
© 1998-2019