Dataset for protein Unclassified of organism Maylandia zebra

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P9BV81_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLRPTNVGQRTERDLAKSLPAYDGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMDELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A3P9CX04_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Maylandia zebra (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPRPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
© 1998-2019