Dataset for protein BCL-2-like of organism Maylandia zebra

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3P9BLI0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L10 (length=273 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9BVM3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Maylandia zebra GN=MCL-1 (length=278 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLISCWDALL
>gnl|bcl2dbpro|A0A3P9D632_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3P9D632_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3P9DIG5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Maylandia zebra GN=BCL-2 (length=228 residues).
MENEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019