Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3Q3KZW1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCCTSPQSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLKQCGPDPCSSLRKVIEELV
ADGHLNWGRVVSLFTFTGVLSRQLMEQKGMKPGLDSGKGQELGQGPESCRGLAETIADYLGEEKKDWLQENDGWEGFCKF
SHSAREVSHDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3M6G2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mastacembelus armatus GN=MCL-1 (length=283 residues).
MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSSTNGYATKSIVADTDD
IEDGSLPCTPELQSDSEAPSCPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEKYRYTYNGMIN
KLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSW
DGFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISYCGVM
>gnl|bcl2dbpro|A0A3Q3M6G2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mastacembelus armatus GN=MCL-1 (length=296 residues).
MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSSTNGYATKSIVADTDD
IEDGSLPCTPELQSDSEAPSCPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEKYRYTYNGMIN
KLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGAVVCQYLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSW
DGFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISRNNKMLTSQSAISAPVSA
>gnl|bcl2dbpro|A0A3Q3MEY1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYVWGFHNVQDEDAANNGSVVAPPPTVVRRCRDASTGPDSESIPQLCRGLPQSDPQAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVEMYDRQRESVFSCSWPSIKTVFGLAALGAASITIGAYLTQK
>gnl|bcl2dbpro|A0A3Q3MX20_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLIYIELNEQQNRTDGGEAESGEEQRIATHANGTFNGTSPGTPPASPLRQEHLQSTASL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLV
GRIVEWMTLYLDNHIEPWIQSQGGWEHFAEIFGQDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
© 1998-2019