Dataset for protein Bcl-xL of organism Mastacembelus armatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q3MX20_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLIYIELNEQQNRTDGGEAESGEEQRIATHANGTFNGTSPGTPPASPLRQEHLQSTASL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLV
GRIVEWMTLYLDNHIEPWIQSQGGWEHFAEIFGQDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
© 1998-2019