Dataset for protein Unclassified of organism Mandrillus leucophaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5YIF7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Mandrillus leucophaeus (length=78 residues).
MARSWLTATSVCQVQENGFVKKLEPKSGWMTFLEVTGKICEMLSSEAILLTRKDTPYCETGLIFLTLKKTIANTYFYF
© 1998-2019