Dataset for protein Unclassified of organism Macrobrachium olfersii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A223FZ28_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Macrobrachium olfersii (length=306 residues).
MAPVTDKIVPKRTNDDESDEGFVSPSVDRVGLRNHKDTIRQSESESGNSSSDNDSQAGSSSSTTTSSESSQALQNSDEEM
EENTAAATGTTHSDNKNSKDEEAAHAKGTTNSDSQTAVTPSAPPAAVVAKDPAAESKAESLAKFVVYTLLEKHNGDSSDK
VERTLLRCVKMMMQKHEILFKGMMKRVQVTRETGYISFVTVANTLFEEDKMVITWSRIVALYAFGGQLALYCKEKGMEDF
ACTVADFMGKYAKEVLTPFVTNIGGWSKICDEFPEETDLENRVRRVLSWTAVGLGVAATVSYLTSR
© 1998-2019