Dataset for protein Unclassified of organism Macaca nemestrina

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6AUD8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Macaca nemestrina (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6AUD8_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Macaca nemestrina (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6E2M6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca nemestrina (length=78 residues).
TAQSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICETLSSEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
© 1998-2019