Dataset for protein Unclassified of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7E8W0_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca mulatta (length=59 residues).
VVQENGFVKKLEPKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTLKKTIANTYFYF
© 1998-2019