Dataset for protein Bcl2l10 of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7H6U5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
© 1998-2019