Dataset for protein Bcl-2 of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1D5QRF2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Macaca mulatta GN=BCL-2 (length=249 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMC
VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGALGDVSLGWGHRFEVRGLECGWAPGARGGCGAGEIKSGLLL
PGVPTSSSG
© 1998-2019