Dataset for protein Unclassified of organism Lubomirskia baicalensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q1RPT4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lubomirskia baicalensis (length=184 residues).
MTAVDGKSETLFREQTRTIVRASLRSYSTTKGDDTATFVATCVADIRTCNHDEFDQMCLQLDASPTSVQPRVVQIFRETF
NDGINWGRIVAFLAFMSHFSADCEKKQLYGSVESICEWSVDLITSHLENWIRAEGGWVAIKKAIDVKTKQQQSQQQQFFG
ANNFMSFVNRGLKAAYRAAVASVY
© 1998-2019