Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|G3SPN0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L1 (length=234 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTGASEGTESEMEIPSAINGNPSRHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWVRTTPLLCFSTSVKEDIAYVFIQVKTYASGKLVQCFLTLTQWFTTQ
>gnl|bcl2dbpro|G3T756_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Loxodonta africana GN=MCL-1 (length=341 residues).
MFGFKRNAVIGLNLYCGGAGLGAGGCATPPGGRLPAPGKEATARQEVGGGDAGASPPAAVAPDGRRVVRPAPIGAEGPDV
TAIPARPTFFAPTRRASPPVEMEALAADAIMSPEEELDGYEPEPLGKRPAVFPRLGLVGEASNGPGTDGSLPSTPPLAEE
EEDELYRQSLEIISRYLQEQATGAKDTKPMGGSGAASRKALETLRRVADGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
MAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIR
NVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G3T8E6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Loxodonta africana GN=BCL2A1 (length=175 residues).
MTDCEFGYIYKLVQDYLKYVLQIPQPAAGSSKTSRVLQNVAFSVQKEVEKNLKPCLDNFVVISIDTAQTIFKQVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWIRQNGGWENGFVKKFEPRSGWLTFLEV
TGKICEMLFLLKQYY
>gnl|bcl2dbpro|G3TMU7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L2 (length=208 residues).
YIHVSLSSLTLAAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLA
AQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVVYLETRLADWIHSSGGWA
EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G3ULB7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL-2 (length=229 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEASAAPPGAAPAPGVLSSPPAAPRGPDTRTSPLQADPAAQPALSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G3ULB7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL-2 (length=168 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEADTRTSPLQADPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WVGACVVE
© 1998-2019