Dataset for protein Bcl-w of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3TMU7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L2 (length=208 residues).
YIHVSLSSLTLAAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLA
AQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVVYLETRLADWIHSSGGWA
EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019