Dataset for protein Bfl1 of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3T8E6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Loxodonta africana GN=BCL2A1 (length=175 residues).
MTDCEFGYIYKLVQDYLKYVLQIPQPAAGSSKTSRVLQNVAFSVQKEVEKNLKPCLDNFVVISIDTAQTIFKQVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWIRQNGGWENGFVKKFEPRSGWLTFLEV
TGKICEMLFLLKQYY
© 1998-2019