Dataset for protein Bcl-2 of organism Loxodonta africana

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3ULB7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL-2 (length=229 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEASAAPPGAAPAPGVLSSPPAAPRGPDTRTSPLQADPAAQPALSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G3ULB7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Loxodonta africana GN=BCL-2 (length=168 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEADTRTSPLQADPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WVGACVVE
© 1998-2019